Human YWHAQ/14-3-3 theta Protein, His Tag
SKU: 72210474835

Human YWHAQ/14-3-3 theta Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 6 - Jul 11

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human YWHAQ/14-3-3 theta Protein, His TagProduct Specification Species Human Synonyms 14 3 3 protein theta, 14 3 3 protein T cell, 14 3 3 protein tau, Protein HS1, YWHAQ Accession P27348 Amino Acid Sequence Protein sequence (P27348, Met1 Asn245, with C His Tag)

Product Specification


Species Human
Synonyms 14-3-3 protein theta, 14-3-3 protein T-cell, 14-3-3 protein tau, Protein HS1, YWHAQ
Accession P27348
Amino Acid Sequence

Protein sequence (P27348, Met1-Asn245, with C-His Tag) MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Expression System E.coli
Molecular Weight

Predicted MW: 29.5 kDa Observed MW: 30 kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

YWHAQ, also known as 14-3-3 tau (τ), is a member of the highly conserved 14-3-3 family of phosphoserine/phosphothreonine-binding proteins. It functions as a key regulatory adapter molecule in eukaryotic cells. By binding to specific phosphorylated client proteins, YWHAQ modulates their activity, stability, subcellular localization, and participation in protein complexes. It is involved in a wide array of vital cellular processes, including signal transduction, cell cycle control, apoptosis, and metabolism. The protein plays a significant role in immune cell signaling and has been implicated in the pathogenesis of cancers and neurodegenerative diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 72210474835

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 558 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
F
Verified Purchase
Fabulous
Louisville, US
★★★★★ 5
High quality duvet!
Size: Twin XL, Color: White, Size: Twin XL, Color: White
Extremely comfortable, soft, and thick duvet! It is also very light despite its thickness, and it makes all my comforters look super fluffy. It keeps me warm without making me sweat. It’s easy to wash, high quality, and it has 3 loops on all 4 sides of the comforter. You could also use this duvet by itself if you wanted to since it is so comfortable and looks like a white comforter on its own. Absolutely love this duvet and do recommend! (I will add another photo of the duvet by itself when I take the duvet cover off to wash it)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
M
Verified Purchase
Morgan
Lowell, US
★★★★★ 5
Super impressed for the price!
Size: Queen, Color: White
I didn’t have super high expectations ordering this, but it ended up being way better than I thought. It’s really soft and has that fluffy look without feeling super heavy. I was worried it would feel cheap or flat, but it actually holds its shape really well. I’ve been using it for a bit now and it still looks good on my bed, not lumpy or uneven. It’s warm enough but not too hot, so I’ve been able to use it comfortably without waking up overheating. I’ve also washed it and it didn’t fall apart or lose its fluff, which was a big thing for me. For the price, it honestly feels like something more expensive. Only thing I’d say is if you like a super thick/heavy comforter, this one is more on the lightweight side, but I personally prefer that. Overall really happy with it and would buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026
M
Verified Purchase
Marie Phillips
Pawtucket, US
★★★★★ 4
Incredible Comfortable
Size: Queen, Color: White
These Utopia queen sheets are extremely comfortable and have a soft, smooth feel that makes sleeping on them really enjoyable. The fabric feels lightweight but still cozy, and they fit the mattress well without slipping off or bunching up. They also wash easily and come out feeling fresh and soft, which makes them great for regular everyday use. Overall, they’re a very comfortable, reliable sheet set that makes the bed feel clean, soft, and inviting every night while still being easy to care for.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
G
Verified Purchase
Grecia Tenorio
Port Orchard, US
★★★★★ 5
It’s cozy and fluffy without it being heavy or too warm.
Size: Queen, Color: White
I ordered this in the color white in the size queen and I have to say I do like it. My only worry was if it was going to be too warm and it is surprisingly very light and airy, but it still gives you that feeling of comfy, which is what I mainly wanted. Right now it is a little warmer throughout the night but every now and then where I live I tend to have to put another blanket on top of me when the weather drops at night, which is annoying however, with this, it provides enough warmth without it being so heavy on you. I have to say for the price I can’t complain.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
J
Verified Purchase
jesus
Lake Worth, US
★★★★★ 5
Great product
Size: King, Color: White
I absolutely love this king-size bedding! The material feels incredibly soft and comfortable, making it perfect for a great night’s sleep. It fits my king bed perfectly with plenty of coverage, and it stays in place without bunching up. The quality is excellent—it feels durable, well-made, and has held up nicely after washing without or shrinking.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026

recommand products