DDB1/CRBN Complex, Flag&His Tag, Human
SKU: 45357149263

DDB1/CRBN Complex, Flag&His Tag, Human

$162.00 $180.00
Save 10%
No.2 Bestseller on ssadisability.org >

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

DDB1/CRBN Complex, Flag&His Tag, HumanProduct Specification Species Human Synonyms DDB1 CRBN Complex Accession Q16531Q96SW2 Amino Acid Sequence DDB1 Flag Tag, Human Met1 His1140

Product Specification


Species Human
Synonyms DDB1/CRBN Complex
Accession Q16531、Q96SW2
Amino Acid Sequence

DDB1 Flag Tag, Human
Met1-His1140
DYKDDDDKMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
CRBN His Tag, Human
Met1-Leu442
HHHHHHHHGGGSGGGSMAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTAEIYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQA
KVQILPECVLPSTMSAVQLESLNKCQIFPSKPVSREDQCSYKWWQKYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIQLLKIGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTIPDTEDEISPDKVILCL
Expression System Baculovirus-InsectCells
Molecular Weight

128&53kDa (Reducing)
Purity ＞95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tags & Cleavage sites Flag Tag; His Tag
Physical Appearance Liquid
Storage Buffer 20mM Tris,300mM NaCl,10%Glycerol,1mM DTT, pH7.5.
Stability & Storage

·12 months from date of receipt, -20 to -70 °C as supplied.
·1 month, 2 to 8 °C under sterile conditions after reconstitution.
·Please avoid repeated freeze-thaw cycles.
Reference

Fischer E.S.,et al. (2014) Nature 512: 49
He Y.J., et al. (2006) Genes Dev. 20: 2949
Ito T., et al. (2010) Science 327: 1345
Wang H., et al. (2006) Mol. Cell 22: 383

Background

Cereblon (CRBN) is the substrate recognition component of DCX (DDB1-CUL4-X-box) E3 Ubiquitin ligase complexes that mediate the ubiquitination of numerous target proteins including the transcriptional regulator MEIS2. CRBN plays an important role in limb outgrowth, and its function in this process is perturbed by the binding of thalidomide and related compounds. Binding of CRBN to Cullin-4 is mediated in part by DNA damage-binding protein 1 (DDB1), a component of multiple DCX class ligases. In addition to its role in limb development, DDB1 is also involved in various DNA damage response mechanisms. This product consists of an untagged complex of DDB1 and CRBN.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 45357149263

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 1763 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
V
Verified Purchase
Val Navarro
Fort Morgan, US
★★★★★ 5
Very Comfortable and Sturdy
Size: 11, Color: Black
I bought these shoes for our grandson and he wears to school Monday through Friday. They fit him perfectly and are so comfortable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 15, 2025
G
Verified Purchase
George M. Occhipinti
Cuba, US
★★★★★ 5
Very handsome shoe
Size: 7, Color: Brown
Beautifully made shoe. Comfortable, great fit. Very handsome on foot. Can wear with anything. Very pleased
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
T
Verified Purchase
toddt0606DC
Draper, US
★★★★★ 5
From a Long Time Hard Sole Dress Shoe Wearer, These are a Must Have!
Size: 12, Color: Blue
I have been wearing hard sole dress shoes for decades and with the full COVID shift to dressing super casual in a professional work environment, I was in the market for some more casual let dressy shoes that were a heck of a lot more comfortable and flexible than my hard soles so I thought I would give this brand and style a try. Oh man, I'm in love. These give you that dressier look yet you can totally dress them down with jeans or cordouroys, so versatile. As I did with my hard soles, I inserted one of my Nike Air in soles and man, these are so comfortable I bought navy and brown! I usually wear these with thin dress socks and they go perfectly with any type of suit set, a no brainer purchase here. I'm a 12 and bought a 12, perfect fit, not to skinny, not to wide, just right. Bottom sole grip is impressive, never felt unstable, solid rubber sole here. I decided to lace them up so there are not tying and the tongue does slip down sometimes so with this feature, best to use a metal shoe horn, then it's super easy to slide them on, they seem to take a beating and remain clean too, I've definitely scuffed them up against many things and still no damage, it's crazy, must have a great finish. NOTE TO Note to MANUFACTURER/SELLER - You need to make a version in GRAY in this specific style and I will buy them instantly, and I assure you they will be incredibly popular! Really not sure why there isn't more colors in these like gray, shades of gray, maybe red, lighter blue and maybe some with different tones in standard colors. Casual dress shoe wearers are looking for new and exciting bold colors so this is the perfect shoe type to deliver on that.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 6, 2024
Z
Verified Purchase
Z. Ed
Port Orchard, US
★★★★★ 5
Finally, a dress shoe that actually feels like a sneaker!
Size: 8.5, Color: Dark Brown
I was honestly super skeptical about buying shoes on Amazon, especially "dress sneakers." Usually, they either look incredibly cheap in person or they completely destroy your heels within an hour. I am so glad I took a chance on these Bruno Marcs. I commute to campus and take the bus almost every day, so I end up doing a ton of walking. I needed something that looked sharp and put-together, but I absolutely refused to sacrifice comfort for a long day on my feet. These completely hit the mark. Right out of the box, there was zero break-in period—no stiffness, no pinching, and no blisters. They are incredibly lightweight, and the material actually looks premium, not like that shiny, fake plastic you sometimes get at this price point. The traction on the bottom is surprisingly good too, which is a lifesaver when I'm rushing to catch my bus on rainy mornings. If you’re on the fence, just get them. It’s rare to find a shoe that balances looking professional with feeling exactly like your favorite weekend sneaker. Easily one of the best wardrobe purchases I've made in a while!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2026
M
Verified Purchase
Milagros Ramos
Lowell, US
★★★★★ 4
High quality, perfect color and very nice price!
Size: 14, Color: Brown, Size: 14, Color: Brown
I bought this shoes for my husband's Christmas present, so he didn't try yet. So far, the color is perfect! I feel like he can wear this shoes with different outfits, for the price it seems hight quality, it is not heavy at all. The shoe features a soft, comfortable lining and the sole is perfect because it is non-slip.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 4, 2025

recommand products

Capto C3-PSC32-CZCDL22055-03
235.72
Grandpa Soap Shampoo - Rosemary - 8 Fl Oz
13.19
Ultima Replenisher Electrolyte Powder - Lemonade - Ca - 3.7 Oz
20.49
MTENR204API
87.69
Native Forest Bamboo Shoots - Sliced - Case Of 6 - 14 Oz.
45.89